PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_30224_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family VOZ
Protein Properties Length: 695aa    MW: 77889.3 Da    PI: 7.0064
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_30224_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ438.39.8e-1354446601217
                         VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecega 83 
                                 pppsaf+gpkcalwdctrpaqgs+w+qdycssfhatlalne++pgt+p+lrp+gi+lkd+ll++a++ak+qgk+vgip+cega
  Cotton_A_30224_BGI-A2_v1.0 444 PPPSAFMGPKCALWDCTRPAQGSDWFQDYCSSFHATLALNEDPPGTNPILRPGGISLKDNLLLDAVRAKAQGKNVGIPQCEGA 526
                                 89********************************************************************************* PP

                         VOZ  84 atakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfe 166
                                 at+kspwna+elfdlsllege irewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkef+g+krsyymdpqps+++e
  Cotton_A_30224_BGI-A2_v1.0 527 ATMKSPWNATELFDLSLLEGEIIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKEFAGQKRSYYMDPQPSGKYE 609
                                 *********************************************************************************** PP

                         VOZ 167 whlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                 whl+eyei+ +da+alyrlelkl+++kks+k+kv kdsladlqkk+grlta
  Cotton_A_30224_BGI-A2_v1.0 610 WHLFEYEIYGCDAFALYRLELKLANQKKSPKAKVPKDSLADLQKKMGRLTA 660
                                 *************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF070475.8E-423125IPR010754Optic atrophy 3-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006508Biological Processproteolysis
GO:0004180Molecular Functioncarboxypeptidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 695 aa     Download sequence    Send to blast
MMLPVLKLGT LALKTACKPI ANRLKKEAGL HPRFRQLIIN FAQANHRFTT TMQRRIYGHA  60
TDVAIRPLNE EKAVQAAADL LGELFVFTVA GAAIIFEVQR SSRSEARKEE QRKQELEAMK  120
QKDEDVAREV ELIKLKIEEL EQLARGRGLA GLFNSRHAHD AEVSKEVFGR NVHRGQKTRV  180
LNTETRRSFS YLSRFPLCLS GDCAGPSLLL PPFPIACNIF LFSSISSLFF LGIFFPFPFF  240
FSEAMQNNSS KNKCTSASHQ QMVDNAKNRL NFLQEQFTDL QAARKEGRAG DVAVLEEQVY  300
QNLREWKAEL CTPSPASSLL GSLGSFSDDI NRLLQLYEEE DDATSPLKES AVLKPEIDDQ  360
SLNPSSLPVI PEDYFVTHEP QEQSFQGFDL CKVSTSANAD INYQLDYHPF DLQQDFDHGH  420
LLDANGTEDY VKDANSNMLP NISPPPSAFM GPKCALWDCT RPAQGSDWFQ DYCSSFHATL  480
ALNEDPPGTN PILRPGGISL KDNLLLDAVR AKAQGKNVGI PQCEGAATMK SPWNATELFD  540
LSLLEGEIIR EWLFFDKPRR AFESGNRKQR SLPDYSGRGW HESRKQVMKE FAGQKRSYYM  600
DPQPSGKYEW HLFEYEIYGC DAFALYRLEL KLANQKKSPK AKVPKDSLAD LQKKMGRLTA  660
EVPGDDKPPG KGKTKANKKA ATAAAAVANV NSAQD
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1660921e-34AC166092.4 Glycine max cultivar Williams 82 clone gmw1-93l19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479645.10.0PREDICTED: transcription factor VOZ1-like isoform X2
RefseqXP_012479644.10.0PREDICTED: transcription factor VOZ1-like isoform X2
SwissprotQ9SGQ01e-175VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0B0MP390.0A0A0B0MP39_G
STRINGPOPTR_0019s12260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-167vascular plant one zinc finger protein